SCOPe 2.06: Domain d3aoea1: 3aoe A:3-187

Lineage for d3aoea1 (3aoe A:3-187)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (29 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [311268] (2 PDB entries)

8. Domain d3aoea1: 3aoe A:3-187 [304972]
   Other proteins in same PDB: d3aoea2, d3aoeb2
   automated match to d4xgia1
   complexed with leu

Details for d3aoea1

PDB Entry: 3aoe, 2.6 Å

PDB Description: Crystal structure of hetero-hexameric glutamate dehydrogenase from Thermus thermophilus (Leu bound form)

PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aoea1:

Sequence; same for both SEQRES and ATOM records:

>d3aoea1 c.58.1.0 (A:3-187) automated matches {Thermus thermophilus [TaxId: 262724]}
seplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvay
fegyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdpr
klspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvt
gkpia

Timeline for d3aoea1:

• d3aoea1 is new in SCOPe 2.06-stable
  
• d3aoea1 appears in SCOPe 2.07
  
• d3aoea1 appears in the current release, SCOPe 2.08