Lineage for d3aoea1 (3aoe A:3-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890865Species Thermus thermophilus [TaxId:262724] [311268] (2 PDB entries)
  8. 2890878Domain d3aoea1: 3aoe A:3-187 [304972]
    Other proteins in same PDB: d3aoea2, d3aoeb2
    automated match to d4xgia1
    complexed with leu

Details for d3aoea1

PDB Entry: 3aoe (more details), 2.6 Å

PDB Description: Crystal structure of hetero-hexameric glutamate dehydrogenase from Thermus thermophilus (Leu bound form)
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d3aoea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aoea1 c.58.1.0 (A:3-187) automated matches {Thermus thermophilus [TaxId: 262724]}
seplsylgkdggpweifteqvdrvvpylgrlaplaeslkrpkrvlivdvpvrlddgsvay
fegyrvhhntargpakggvryhpevtlsevmalagwmtiknaavglpygggkggirvdpr
klspgelerltrrytseigillgpdrdipapdvntgeremawmmdtysmnvgrtvpgvvt
gkpia

SCOPe Domain Coordinates for d3aoea1:

Click to download the PDB-style file with coordinates for d3aoea1.
(The format of our PDB-style files is described here.)

Timeline for d3aoea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aoea2