Lineage for d3anva2 (3anv A:19-262)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092317Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
    circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand
  5. 2092318Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)
  6. 2092345Protein D-serine dehydratase [310801] (2 species)
  7. 2092346Species Chicken (Gallus gallus) [TaxId:9031] [311066] (4 PDB entries)
  8. 2092348Domain d3anva2: 3anv A:19-262 [304971]
    Other proteins in same PDB: d3anva1
    automated match to d3anua2
    complexed with 2ra, cl, plp, zn

Details for d3anva2

PDB Entry: 3anv (more details), 2.09 Å

PDB Description: Crystal structure of D-serine dehydratase from chicken kidney (2,3-DAP complex)
PDB Compounds: (A:) D-serine dehydratase

SCOPe Domain Sequences for d3anva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3anva2 c.1.6.1 (A:19-262) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
rttarrnaermrercralgvrlrphvkthktleggllatggtrrgiavstlaearffadg
gfddillaypvptarleecaglarrldafhvlldrpealaslrqrplghgkrwlvwlkld
cgngragvrptdpaalelaqaiandapeevtlvgvyahcgntygcsgadtiqaiartttn
avlsfvaalrqagvpcpqasigstpscshpipemsqltelhpgnyifydlqqtqlgscqp
qdva

SCOPe Domain Coordinates for d3anva2:

Click to download the PDB-style file with coordinates for d3anva2.
(The format of our PDB-style files is described here.)

Timeline for d3anva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3anva1