SCOPe 2.07: Domain d3anva1: 3anv A:2-18,A:263-376

Lineage for d3anva1 (3anv A:2-18,A:263-376)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)

6. Protein D-serine dehydratase [310800] (2 species)
   Pfam PF14031

7. Species Chicken (Gallus gallus) [TaxId:9031] [311064] (4 PDB entries)

8. Domain d3anva1: 3anv A:2-18,A:263-376 [304970]
   Other proteins in same PDB: d3anva2
   automated match to d3anua1
   complexed with 2ra, cl, plp, zn

Details for d3anva1

PDB Entry: 3anv, 2.09 Å

PDB Description: Crystal structure of D-serine dehydratase from chicken kidney (2,3-DAP complex)

PDB Compounds: (A:) D-serine dehydratase

SCOPe Domain Sequences for d3anva1:

Sequence, based on SEQRES records:

>d3anva1 b.49.2.2 (A:2-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
wlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagqgpqgcaa
idghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvheeg
kvvalwhpvrgw

Sequence, based on observed residues (ATOM records):

>d3anva1 b.49.2.2 (A:2-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
wlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagpqgcaaid
ghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvheegkv
valwhpvrgw

Timeline for d3anva1:

• d3anva1 first appeared in SCOPe 2.06
  
• d3anva1 appears in the current release, SCOPe 2.08