Lineage for d3anua1 (3anu A:1-18,A:263-376)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2390559Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2390884Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2390885Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 protein domains)
  6. 2390912Protein D-serine dehydratase [310800] (2 species)
    Pfam PF14031
  7. 2390913Species Chicken (Gallus gallus) [TaxId:9031] [311064] (4 PDB entries)
  8. 2390914Domain d3anua1: 3anu A:1-18,A:263-376 [304968]
    Other proteins in same PDB: d3anua2
    complexed with cl, plp, zn

Details for d3anua1

PDB Entry: 3anu (more details), 1.9 Å

PDB Description: Crystal structure of D-serine dehydratase from chicken kidney
PDB Compounds: (A:) D-serine dehydratase

SCOPe Domain Sequences for d3anua1:

Sequence, based on SEQRES records: (download)

>d3anua1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgagagqgpqgca
aidghpelrlvgltqehgllehaggqmdfgrfpvgsvlalipyhacataamhpvyyvhee
gkvvalwhpvrgw

Sequence, based on observed residues (ATOM records): (download)

>d3anua1 b.49.2.2 (A:1-18,A:263-376) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}
mwlgalldtlptpaltidXirvltrvighyahrgqllvdcgwaalslhgaggpqgcaaid
ghpelrlvgltqehgllehqmdfgrfpvgsvlalipyhacataamhpvyyvheegkvval
whpvrgw

SCOPe Domain Coordinates for d3anua1:

Click to download the PDB-style file with coordinates for d3anua1.
(The format of our PDB-style files is described here.)

Timeline for d3anua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3anua2