| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein Trypanothione reductase [51947] (3 species) |
| Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries) |
| Domain d1febb2: 1feb B:170-286 [30496] Other proteins in same PDB: d1feba3, d1febb3 complexed with fad |
PDB Entry: 1feb (more details), 2 Å
SCOPe Domain Sequences for d1febb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1febb2 c.3.1.5 (B:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr
Timeline for d1febb2: