Lineage for d3agje6 (3agj E:323-432)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403547Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2403548Protein automated matches [254425] (18 species)
    not a true protein
  7. 2403552Species Aeropyrum pernix [TaxId:56636] [255748] (2 PDB entries)
  8. 2403558Domain d3agje6: 3agj E:323-432 [304959]
    Other proteins in same PDB: d3agja4, d3agja5, d3agjc4, d3agjc5, d3agje4, d3agje5, d3agjg4, d3agjg5
    automated match to d3wxme3
    complexed with gtp, mg

Details for d3agje6

PDB Entry: 3agj (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (E:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3agje6:

Sequence; same for both SEQRES and ATOM records: (download)

>d3agje6 b.44.1.0 (E:323-432) automated matches {Aeropyrum pernix [TaxId: 56636]}
aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka
gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpakv

SCOPe Domain Coordinates for d3agje6:

Click to download the PDB-style file with coordinates for d3agje6.
(The format of our PDB-style files is described here.)

Timeline for d3agje6: