| Class b: All beta proteins [48724] (177 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (16 species) not a true protein |
| Species Aeropyrum pernix [TaxId:56636] [255748] (2 PDB entries) |
| Domain d3agjc6: 3agj C:323-434 [304956] Other proteins in same PDB: d3agja4, d3agja5, d3agjc4, d3agjc5, d3agje4, d3agje5, d3agjg4, d3agjg5 automated match to d3wxme3 complexed with gtp, mg |
PDB Entry: 3agj (more details), 2.3 Å
SCOPe Domain Sequences for d3agjc6:
Sequence; same for both SEQRES and ATOM records: (download)
>d3agjc6 b.44.1.0 (C:323-434) automated matches {Aeropyrum pernix [TaxId: 56636]}
aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka
gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpakvdi
Timeline for d3agjc6: