Lineage for d3agjc4 (3agj C:4-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871595Species Aeropyrum pernix [TaxId:56636] [255746] (2 PDB entries)
  8. 2871600Domain d3agjc4: 3agj C:4-227 [304954]
    Other proteins in same PDB: d3agja5, d3agja6, d3agjc5, d3agjc6, d3agje5, d3agje6, d3agjg5, d3agjg6
    automated match to d3wxme1
    complexed with gtp, mg

Details for d3agjc4

PDB Entry: 3agj (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (C:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3agjc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3agjc4 c.37.1.0 (C:4-227) automated matches {Aeropyrum pernix [TaxId: 56636]}
kphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkmk
eerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgefe
agmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgyq
vdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppak

SCOPe Domain Coordinates for d3agjc4:

Click to download the PDB-style file with coordinates for d3agjc4.
(The format of our PDB-style files is described here.)

Timeline for d3agjc4: