Lineage for d3agja5 (3agj A:228-322)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793305Species Aeropyrum pernix [TaxId:56636] [255747] (2 PDB entries)
  8. 2793309Domain d3agja5: 3agj A:228-322 [304952]
    Other proteins in same PDB: d3agja4, d3agja6, d3agjc4, d3agjc6, d3agje4, d3agje6, d3agjg4, d3agjg6
    automated match to d3vmfa2
    complexed with gtp, mg

Details for d3agja5

PDB Entry: 3agj (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3agja5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3agja5 b.43.3.0 (A:228-322) automated matches {Aeropyrum pernix [TaxId: 56636]}
pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq
qaepgdnigfavrgvsksdikrgdvaghldkpptv

SCOPe Domain Coordinates for d3agja5:

Click to download the PDB-style file with coordinates for d3agja5.
(The format of our PDB-style files is described here.)

Timeline for d3agja5: