![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) |
![]() | Protein Trypanothione reductase [51947] (2 species) |
![]() | Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries) |
![]() | Domain d1feba2: 1feb A:170-286 [30494] Other proteins in same PDB: d1feba3, d1febb3 |
PDB Entry: 1feb (more details), 2 Å
SCOP Domain Sequences for d1feba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1feba2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata} gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr
Timeline for d1feba2: