Lineage for d1feba2 (1feb A:170-286)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 21089Protein Trypanothione reductase [51947] (2 species)
  7. 21090Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 21096Domain d1feba2: 1feb A:170-286 [30494]
    Other proteins in same PDB: d1feba3, d1febb3

Details for d1feba2

PDB Entry: 1feb (more details), 2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.0 angstrom resolution

SCOP Domain Sequences for d1feba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feba2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr

SCOP Domain Coordinates for d1feba2:

Click to download the PDB-style file with coordinates for d1feba2.
(The format of our PDB-style files is described here.)

Timeline for d1feba2: