Lineage for d1feba2 (1feb A:170-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850194Protein Trypanothione reductase, middle domain [418955] (3 species)
  7. Species Crithidia fasciculata [TaxId:5656] [419411] (6 PDB entries)
  8. 2850198Domain d1feba2: 1feb A:170-286 [30494]
    Other proteins in same PDB: d1feba1, d1feba3, d1febb1, d1febb3
    complexed with fad

Details for d1feba2

PDB Entry: 1feb (more details), 2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.0 angstrom resolution
PDB Compounds: (A:) trypanothione reductase

SCOPe Domain Sequences for d1feba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feba2 c.3.1.5 (A:170-286) Trypanothione reductase, middle domain {Crithidia fasciculata [TaxId: 5656]}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr

SCOPe Domain Coordinates for d1feba2:

Click to download the PDB-style file with coordinates for d1feba2.
(The format of our PDB-style files is described here.)

Timeline for d1feba2: