Lineage for d3aema_ (3aem A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897022Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [311267] (8 PDB entries)
  8. 2897039Domain d3aema_: 3aem A: [304935]
    automated match to d3ri6a_
    complexed with 2lm, gol, met, so4

Details for d3aema_

PDB Entry: 3aem (more details), 2.2 Å

PDB Description: reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 containing michaelis complex and methionine imine- pyridoxamine-5'-phosphate
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d3aema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aema_ c.67.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
pelvrisvgienvddiiadlkqalelw

SCOPe Domain Coordinates for d3aema_:

Click to download the PDB-style file with coordinates for d3aema_.
(The format of our PDB-style files is described here.)

Timeline for d3aema_: