Lineage for d3a9aa_ (3a9a A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110411Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2110412Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2110481Family c.6.1.0: automated matches [195757] (1 protein)
    not a true family
  6. 2110482Protein automated matches [195758] (2 species)
    not a true protein
  7. 2110483Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (9 PDB entries)
  8. 2110486Domain d3a9aa_: 3a9a A: [304914]
    automated match to d3a9ba_
    complexed with cbi, mg, rcb

Details for d3a9aa_

PDB Entry: 3a9a (more details), 1.4 Å

PDB Description: CcCel6C, a glycoside hydrolase family 6 enzyme, complexed with p-nitrophenyl beta-D-cellotrioside
PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3a9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9aa_ c.6.1.0 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
vnpyigrsplviksyaekleetiayfeaqgdelnaartrtvqgiptfawisdsatidtiq
pliadavahqeasgeqvlvqlviynlpdrdcaakasdgefhldddgankyrayvdrivae
lstadadklhfsivlepdslgnmvtnmhvpkcqgaataykegiaytiaslqkpnidlyid
aahggwlgwndnlrpsaeifketldlarqitpnatvrglainvsnynpyktraredytew
nnaydewnyvktltphlqavgfpaqfivdqgrsgregirtewgqwcnirnagfgirpttd
qaivdsanvdaivwvkpggesdgtsdvnavrfdencrspashvpapeagewfnefvvnlv
inanppleptya

SCOPe Domain Coordinates for d3a9aa_:

Click to download the PDB-style file with coordinates for d3a9aa_.
(The format of our PDB-style files is described here.)

Timeline for d3a9aa_: