SCOPe 2.06: Domain d3a9aa_: 3a9a A:

Lineage for d3a9aa_ (3a9a A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families)

5. Family c.6.1.0: automated matches [195757] (1 protein)
   not a true family

6. Protein automated matches [195758] (2 species)
   not a true protein

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (9 PDB entries)

8. Domain d3a9aa_: 3a9a A: [304914]
   automated match to d3a9ba_
   complexed with cbi, mg, rcb

Details for d3a9aa_

PDB Entry: 3a9a, 1.4 Å

PDB Description: CcCel6C, a glycoside hydrolase family 6 enzyme, complexed with p-nitrophenyl beta-D-cellotrioside

PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3a9aa_:

Sequence; same for both SEQRES and ATOM records:

>d3a9aa_ c.6.1.0 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
vnpyigrsplviksyaekleetiayfeaqgdelnaartrtvqgiptfawisdsatidtiq
pliadavahqeasgeqvlvqlviynlpdrdcaakasdgefhldddgankyrayvdrivae
lstadadklhfsivlepdslgnmvtnmhvpkcqgaataykegiaytiaslqkpnidlyid
aahggwlgwndnlrpsaeifketldlarqitpnatvrglainvsnynpyktraredytew
nnaydewnyvktltphlqavgfpaqfivdqgrsgregirtewgqwcnirnagfgirpttd
qaivdsanvdaivwvkpggesdgtsdvnavrfdencrspashvpapeagewfnefvvnlv
inanppleptya

Timeline for d3a9aa_:

• d3a9aa_ is new in SCOPe 2.06-stable
  
• d3a9aa_ appears in SCOPe 2.07
  
• d3a9aa_ appears in the current release, SCOPe 2.08