Lineage for d3a5cl1 (3a5c L:7-78)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408328Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins)
  6. 2408343Protein V1 ATP synthase B subunit, domain 1 [310702] (2 species)
  7. 2408348Species Thermus thermophilus HB8 [TaxId:300852] [310926] (2 PDB entries)
  8. 2408354Domain d3a5cl1: 3a5c L:7-78 [304903]
    Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd2, d3a5cd3, d3a5ce2, d3a5ce3, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl2, d3a5cl3, d3a5cm2, d3a5cm3, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
    complexed with adp

Details for d3a5cl1

PDB Entry: 3a5c (more details), 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase
PDB Compounds: (L:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3a5cl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5cl1 b.49.1.2 (L:7-78) V1 ATP synthase B subunit, domain 1 {Thermus thermophilus HB8 [TaxId: 300852]}
eytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvfeettgl
dlattsvslved

SCOPe Domain Coordinates for d3a5cl1:

Click to download the PDB-style file with coordinates for d3a5cl1.
(The format of our PDB-style files is described here.)

Timeline for d3a5cl1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_