SCOPe 2.06: Domain d3a5ck2: 3a5c K:71-112,K:185-431

Lineage for d3a5ck2 (3a5c K:71-112,K:185-431)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein V1 ATP synthase A subunit, central domain [310703] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310929] (2 PDB entries)

8. Domain d3a5ck2: 3a5c K:71-112,K:185-431 [304900]
   Other proteins in same PDB: d3a5ca1, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
   complexed with adp

Details for d3a5ck2

PDB Entry: 3a5c, 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase

PDB Compounds: (K:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3a5ck2:

Sequence, based on SEQRES records:

>d3a5ck2 c.37.1.11 (K:71-112,K:185-431) V1 ATP synthase A subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
lavelgpgmlngiydgiqrplerirektgiyitrgvvvhaldXhtwpvrrarpvqrkldp
ntpfltgmrildvlfpvamggtaaipgpfgsgktvtqqslakwsnadvvvyvgcgergne
mtdvlvefpeltdpktggplmhrtvliantsnmpvaareasiyvgvtiaeyfrdqgfsva
lmadstsrwaealreissrleempaeegyppylaarlaafyeragkvitlggeegavtiv
gavsppggdmsepvtqstlrivgafwrldaslafrrhfpainwngsyslf

Sequence, based on observed residues (ATOM records):

>d3a5ck2 c.37.1.11 (K:71-112,K:185-431) V1 ATP synthase A subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
lavelgpgmlngiydgiqrplvhaldXhtwpvrrarpvqrkldpntpfltgmrildvlfp
vamggtaaipgpfgsgktvtqqslakwsnadvvvyvgcgergnemtdvlvefpeltdpkt
ggplmhrtvliantsnmpvaareasiyvgvtiaeyfrdqgfsvalmadstsrwaealrei
ssrleempaeegyppylaarlaafyeragkvitlggeegavtivgavsppggdmsepvtq
stlrivgafwrldaslafrrhfpainwngsyslf

Timeline for d3a5ck2:

• d3a5ck2 is new in SCOPe 2.06-stable
  
• d3a5ck2 appears in SCOPe 2.07
  
• d3a5ck2 appears in the current release, SCOPe 2.08