Lineage for d1feca2 (1fec A:170-286)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119373Protein Trypanothione reductase [51947] (2 species)
  7. 119374Species Crithidia fasciculata [TaxId:5656] [51948] (6 PDB entries)
  8. 119376Domain d1feca2: 1fec A:170-286 [30490]
    Other proteins in same PDB: d1feca3, d1fecb3

Details for d1feca2

PDB Entry: 1fec (more details), 1.7 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 1.7 angstrom resolution

SCOP Domain Sequences for d1feca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata}
gddlcitsneafyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgf
dselrkqlteqlranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigr

SCOP Domain Coordinates for d1feca2:

Click to download the PDB-style file with coordinates for d1feca2.
(The format of our PDB-style files is described here.)

Timeline for d1feca2: