SCOPe 2.06: Domain d3a5cj4: 3a5c J:432-577

Lineage for d3a5cj4 (3a5c J:432-577)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)

6. Protein V1 ATP synthase A subunit, C-terminal domain [310709] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310942] (2 PDB entries)

8. Domain d3a5cj4: 3a5c J:432-577 [304898]
   Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5cj1, d3a5cj2, d3a5cj3, d3a5ck1, d3a5ck2, d3a5ck3, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
   complexed with adp

Details for d3a5cj4

PDB Entry: 3a5c, 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase

PDB Compounds: (J:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3a5cj4:

Sequence; same for both SEQRES and ATOM records:

>d3a5cj4 a.69.1.2 (J:432-577) V1 ATP synthase A subunit, C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
tsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdaerlvievgriir
edflqqnayhevdaycsmkkaygimkmilafykeaeaaikrgvsideilqlpvlerigra
ryvseeefpayfeeamkeiqgafkal

Timeline for d3a5cj4:

• d3a5cj4 is new in SCOPe 2.06-stable
  
• d3a5cj4 appears in SCOPe 2.07
  
• d3a5cj4 appears in the current release, SCOPe 2.08