Lineage for d3a5cd3 (3a5c D:362-463)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717499Family a.69.1.2: C-terminal domain of A and B subunits of V1 ATP synthase and A1 ATP sythase [310617] (3 proteins)
  6. 2717519Protein V1 ATP synthase B subunit, C-terminal domain [310710] (2 species)
  7. 2717524Species Thermus thermophilus HB8 [TaxId:300852] [310944] (2 PDB entries)
  8. 2717527Domain d3a5cd3: 3a5c D:362-463 [304882]
    Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5ce1, d3a5ce2, d3a5cf1, d3a5cf2, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cm1, d3a5cm2, d3a5cn1, d3a5cn2, d3a5co_, d3a5cp_
    complexed with adp

Details for d3a5cd3

PDB Entry: 3a5c (more details), 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase
PDB Compounds: (D:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3a5cd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5cd3 a.69.1.2 (D:362-463) V1 ATP synthase B subunit, C-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]}
mnngvgkgktredhkqvsdqlysayangvdirklvaiigedaltendrrylqfadaferf
finqgqqnrsieeslqiawallsmlpqgelkriskdhigkyy

SCOPe Domain Coordinates for d3a5cd3:

Click to download the PDB-style file with coordinates for d3a5cd3.
(The format of our PDB-style files is described here.)

Timeline for d3a5cd3:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_