SCOP 1.59: Domain d1geub2: 1geu B:147-262

Lineage for d1geub2 (1geu B:147-262)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)

6. Protein Glutathione reductase [51944] (2 species)

7. Species Escherichia coli [TaxId:562] [51946] (4 PDB entries)

8. Domain d1geub2: 1geu B:147-262 [30488]
   Other proteins in same PDB: d1geua3, d1geub3

Details for d1geub2

PDB Entry: 1geu, 2.2 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1geub2:

Sequence; same for both SEQRES and ATOM records:

>d1geub2 c.3.1.5 (B:147-262) Glutathione reductase {Escherichia coli}
dipgveygidsdgffalpalpervavvgagyigvelggvinglgakthlfemfdaplpsf
dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig

Timeline for d1geub2:

• d1geub2 first appeared (with stable ids) in SCOP 1.55
  
• d1geub2 appears in SCOP 1.57
  
• d1geub2 appears in SCOP 1.61
  
• d1geub2 appears in the current release, SCOPe 2.08