Lineage for d3a5cc3 (3a5c C:113-184)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2427187Superfamily b.84.5: V1 ATP synthase A subunit, bulge domain-like [310577] (1 family) (S)
    PubMed 19893485
  5. 2427188Family b.84.5.1: V1 ATP synthase A subunit, bulge domain-like [310616] (2 proteins)
  6. 2427194Protein V1 ATP synthase A subunit, bulge domain [310706] (2 species)
  7. 2427199Species Thermus thermophilus HB8 [TaxId:300852] [310935] (2 PDB entries)
  8. 2427204Domain d3a5cc3: 3a5c C:113-184 [304878]
    Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
    complexed with adp

Details for d3a5cc3

PDB Entry: 3a5c (more details), 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase
PDB Compounds: (C:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3a5cc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5cc3 b.84.5.1 (C:113-184) V1 ATP synthase A subunit, bulge domain {Thermus thermophilus HB8 [TaxId: 300852]}
rekkwawtpmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepv
vvledgtelkmy

SCOPe Domain Coordinates for d3a5cc3:

Click to download the PDB-style file with coordinates for d3a5cc3.
(The format of our PDB-style files is described here.)

Timeline for d3a5cc3:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_