Lineage for d3a5cb2 (3a5c B:71-112,B:185-431)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2478095Protein V1 ATP synthase A subunit, central domain [310703] (2 species)
  7. 2478100Species Thermus thermophilus HB8 [TaxId:300852] [310929] (2 PDB entries)
  8. 2478104Domain d3a5cb2: 3a5c B:71-112,B:185-431 [304873]
    Other proteins in same PDB: d3a5ca1, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
    complexed with adp

Details for d3a5cb2

PDB Entry: 3a5c (more details), 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase
PDB Compounds: (B:) V-type ATP synthase alpha chain

SCOPe Domain Sequences for d3a5cb2:

Sequence, based on SEQRES records: (download)

>d3a5cb2 c.37.1.11 (B:71-112,B:185-431) V1 ATP synthase A subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
lavelgpgmlngiydgiqrplerirektgiyitrgvvvhaldXhtwpvrrarpvqrkldp
ntpfltgmrildvlfpvamggtaaipgpfgsgktvtqqslakwsnadvvvyvgcgergne
mtdvlvefpeltdpktggplmhrtvliantsnmpvaareasiyvgvtiaeyfrdqgfsva
lmadstsrwaealreissrleempaeegyppylaarlaafyeragkvitlggeegavtiv
gavsppggdmsepvtqstlrivgafwrldaslafrrhfpainwngsyslf

Sequence, based on observed residues (ATOM records): (download)

>d3a5cb2 c.37.1.11 (B:71-112,B:185-431) V1 ATP synthase A subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
lavelgpgmlngiydgiqrplvhaldXhtwpvrrarpvqrkldpntpfltgmrildvlfp
vamggtaaipgpfgsgktvtqqslakwsnadvvvyvgcgergnemtdvlvefpeltdpkt
ggplmhrtvliantsnmpvaareasiyvgvtiaeyfrdqgfsvalmadstsrwaealrei
ssrleempaeegyppylaarlaafyeragkvitlggeegavtivgavsppggdmsepvtq
stlrivgafwrldaslafrrhfpainwngsyslf

SCOPe Domain Coordinates for d3a5cb2:

Click to download the PDB-style file with coordinates for d3a5cb2.
(The format of our PDB-style files is described here.)

Timeline for d3a5cb2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_