Lineage for d3a3yb2 (3a3y B:69-305)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033698Superfamily b.1.32: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310575] (1 family) (S)
    May be homologous to IL1R (49177), according to PubMed 18075585
  5. 2033699Family b.1.32.1: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310613] (2 protein domains)
  6. 2033716Protein automated matches [310866] (1 species)
    not a true protein
  7. 2033717Species Dogfish (Squalus acanthias) [TaxId:7797] [311266] (1 PDB entry)
  8. 2033718Domain d3a3yb2: 3a3y B:69-305 [304866]
    Other proteins in same PDB: d3a3ya1, d3a3ya2, d3a3ya3, d3a3ya4, d3a3yb1, d3a3yg_
    automated match to d2zxeb2
    complexed with clr, k, mf4, mg, nag, obn

Details for d3a3yb2

PDB Entry: 3a3y (more details), 2.8 Å

PDB Description: Crystal structure of the sodium-potassium pump with bound potassium and ouabain
PDB Compounds: (B:) Na+,K+-ATPase beta subunit

SCOPe Domain Sequences for d3a3yb2:

Sequence, based on SEQRES records: (download)

>d3a3yb2 b.1.32.1 (B:69-305) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncsglddttygyaegkpcvvaklnriigfy
pkplknttdlpeqlqanynqyvlplrcaakreedrekigsieyfglggyagfplqyypyy
gkrlqkkylqpllaiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Sequence, based on observed residues (ATOM records): (download)

>d3a3yb2 b.1.32.1 (B:69-305) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncgyaegkpcvvaklnriigfypkplkntt
dlpeqlqanynqyvlplrcaarekigsieyfglggyagfplqyypyygkrlqkkylqpll
aiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

SCOPe Domain Coordinates for d3a3yb2:

Click to download the PDB-style file with coordinates for d3a3yb2.
(The format of our PDB-style files is described here.)

Timeline for d3a3yb2:

  • d3a3yb2 is new in SCOPe 2.06-stable