SCOPe 2.08: Domain d3a3yb2: 3a3y B:69-305

Lineage for d3a3yb2 (3a3y B:69-305)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.32: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310575] (2 families)
   May be homologous to IL1R (49177), according to PubMed 18075585

5. Family b.1.32.1: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310613] (2 proteins)

6. Protein automated matches [310866] (1 species)
   not a true protein

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [311266] (1 PDB entry)

8. Domain d3a3yb2: 3a3y B:69-305 [304866]
   Other proteins in same PDB: d3a3ya1, d3a3ya2, d3a3ya3, d3a3ya4, d3a3yb1, d3a3yg_
   automated match to d2zxeb2
   complexed with clr, k, mf4, mg, nag, obn

Details for d3a3yb2

PDB Entry: 3a3y, 2.8 Å

PDB Description: crystal structure of the sodium-potassium pump with bound potassium and ouabain

PDB Compounds: (B:) Na+,K+-ATPase beta subunit

SCOPe Domain Sequences for d3a3yb2:

Sequence, based on SEQRES records:

>d3a3yb2 b.1.32.1 (B:69-305) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncsglddttygyaegkpcvvaklnriigfy
pkplknttdlpeqlqanynqyvlplrcaakreedrekigsieyfglggyagfplqyypyy
gkrlqkkylqpllaiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Sequence, based on observed residues (ATOM records):

>d3a3yb2 b.1.32.1 (B:69-305) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncgyaegkpcvvaklnriigfypkplkntt
dlpeqlqanynqyvlplrcaarekigsieyfglggyagfplqyypyygkrlqkkylqpll
aiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Timeline for d3a3yb2:

• d3a3yb2 first appeared in SCOPe 2.06
  
• d3a3yb2 appears in SCOPe 2.07