Lineage for d2zzzc_ (2zzz C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123583Protein Guanylate kinase [52542] (5 species)
  7. 2123584Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52543] (6 PDB entries)
  8. 2123588Domain d2zzzc_: 2zzz C: [304858]
    automated match to d1gkya_
    complexed with act, cl, mg; mutant

Details for d2zzzc_

PDB Entry: 2zzz (more details), 1.82 Å

PDB Description: Crystal structure of apo form of yeast guanylate kinase E69D mutant at 1.82 angstrom resolution
PDB Compounds: (C:) Guanylate kinase

SCOPe Domain Sequences for d2zzzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zzzc_ c.37.1.1 (C:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srpivisgpsgtgkstllkklfaeypdsfgfsvssttrtpragevngkdynfvsvdefks
miknnefidwaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflfi
appsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkaykelkd
fifaek

SCOPe Domain Coordinates for d2zzzc_:

Click to download the PDB-style file with coordinates for d2zzzc_.
(The format of our PDB-style files is described here.)

Timeline for d2zzzc_: