SCOPe 2.07: Domain d2zzyb_: 2zzy B:

Lineage for d2zzyb_ (2zzy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52543] (6 PDB entries)

8. Domain d2zzyb_: 2zzy B: [304855]
   automated match to d1gkya_
   mutant

Details for d2zzyb_

PDB Entry: 2zzy, 1.9 Å

PDB Description: Crystal structure of apo form of yeast guanylate kinase N168A mutant at 1.90 angstrom resolution

PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d2zzyb_:

Sequence; same for both SEQRES and ATOM records:

>d2zzyb_ c.37.1.1 (B:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srpivisgpsgtgkstllkklfaeypdsfgfsvssttrtpragevngkdynfvsvdefks
miknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflfi
appsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivaddldkaykelkd
fifaek

Timeline for d2zzyb_:

• d2zzyb_ first appeared in SCOPe 2.06
  
• d2zzyb_ appears in the current release, SCOPe 2.08