Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.43: ATP1G1/PLM/MAT8-like (FXYD-like) [310576] (1 family) Pfam PF02038 |
Family f.23.43.1: ATP1G1/PLM/MAT8-like (FXYD-like) [310614] (5 proteins) |
Protein Phospholemman-like protein, FXYD10 [310697] (1 species) |
Species Dogfish (Squalus acanthias) [TaxId:7797] [310919] (15 PDB entries) |
Domain d2zxeg_: 2zxe G: [304852] Other proteins in same PDB: d2zxea1, d2zxea2, d2zxea3, d2zxea4, d2zxeb1, d2zxeb2 complexed with clr, k, mf4, mg, nag |
PDB Entry: 2zxe (more details), 2.4 Å
SCOPe Domain Sequences for d2zxeg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxeg_ f.23.43.1 (G:) Phospholemman-like protein, FXYD10 {Dogfish (Squalus acanthias) [TaxId: 7797]} egpdnderftydyyrlrvvglivaavlcvigiiillagk
Timeline for d2zxeg_: