Lineage for d2zxeg_ (2zxe G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026929Superfamily f.23.43: ATP1G1/PLM/MAT8-like (FXYD-like) [310576] (1 family) (S)
    Pfam PF02038
  5. 3026930Family f.23.43.1: ATP1G1/PLM/MAT8-like (FXYD-like) [310614] (5 proteins)
  6. 3026931Protein Phospholemman-like protein, FXYD10 [310697] (1 species)
  7. 3026932Species Dogfish (Squalus acanthias) [TaxId:7797] [310919] (15 PDB entries)
  8. 3026933Domain d2zxeg_: 2zxe G: [304852]
    Other proteins in same PDB: d2zxea1, d2zxea2, d2zxea3, d2zxea4, d2zxeb1, d2zxeb2
    complexed with clr, k, mf4, mg, nag

Details for d2zxeg_

PDB Entry: 2zxe (more details), 2.4 Å

PDB Description: crystal structure of the sodium - potassium pump in the e2.2k+.pi state
PDB Compounds: (G:) Phospholemman-like protein

SCOPe Domain Sequences for d2zxeg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxeg_ f.23.43.1 (G:) Phospholemman-like protein, FXYD10 {Dogfish (Squalus acanthias) [TaxId: 7797]}
egpdnderftydyyrlrvvglivaavlcvigiiillagk

SCOPe Domain Coordinates for d2zxeg_:

Click to download the PDB-style file with coordinates for d2zxeg_.
(The format of our PDB-style files is described here.)

Timeline for d2zxeg_: