SCOPe 2.08: Domain d2zxeb2: 2zxe B:69-305

Lineage for d2zxeb2 (2zxe B:69-305)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.32: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310575] (2 families)
   May be homologous to IL1R (49177), according to PubMed 18075585

5. Family b.1.32.1: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310613] (2 proteins)

6. Protein Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310696] (1 species)

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [310918] (14 PDB entries)

8. Domain d2zxeb2: 2zxe B:69-305 [304851]
   Other proteins in same PDB: d2zxea1, d2zxea2, d2zxea3, d2zxea4, d2zxeb1, d2zxeg_
   complexed with clr, k, mf4, mg, nag

Details for d2zxeb2

PDB Entry: 2zxe, 2.4 Å

PDB Description: crystal structure of the sodium - potassium pump in the e2.2k+.pi state

PDB Compounds: (B:) Na+,K+-ATPase beta subunit

SCOPe Domain Sequences for d2zxeb2:

Sequence, based on SEQRES records:

>d2zxeb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncsglddttygyaegkpcvvaklnriigfy
pkplknttdlpeelqanynqyvlplrcaakreedrekigsieyfglggyagfplqyypyy
gkrlqkkylqpllaiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Sequence, based on observed residues (ATOM records):

>d2zxeb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncgyaegkpcvvaklnriigfypkplkntt
dlpeelqanynqyvlplrcaarekigsieyfglggyagfplqyypyygkrlqkkylqpll
aiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Timeline for d2zxeb2:

• d2zxeb2 first appeared in SCOPe 2.06
  
• d2zxeb2 appears in SCOPe 2.07