Lineage for d2zxeb2 (2zxe B:69-305)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033698Superfamily b.1.32: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310575] (1 family) (S)
    May be homologous to IL1R (49177), according to PubMed 18075585
  5. 2033699Family b.1.32.1: Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310613] (2 protein domains)
  6. 2033700Protein Sodium/potassium-transporting ATPase, beta subunit extracellular domain [310696] (1 species)
  7. 2033701Species Dogfish (Squalus acanthias) [TaxId:7797] [310918] (14 PDB entries)
  8. 2033702Domain d2zxeb2: 2zxe B:69-305 [304851]
    Other proteins in same PDB: d2zxea1, d2zxea2, d2zxea3, d2zxea4, d2zxeb1, d2zxeg_
    complexed with clr, k, mf4, mg, nag

Details for d2zxeb2

PDB Entry: 2zxe (more details), 2.4 Å

PDB Description: Crystal structure of the sodium - potassium pump in the E2.2K+.Pi state
PDB Compounds: (B:) Na+,K+-ATPase beta subunit

SCOPe Domain Sequences for d2zxeb2:

Sequence, based on SEQRES records: (download)

>d2zxeb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncsglddttygyaegkpcvvaklnriigfy
pkplknttdlpeelqanynqyvlplrcaakreedrekigsieyfglggyagfplqyypyy
gkrlqkkylqpllaiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

Sequence, based on observed residues (ATOM records): (download)

>d2zxeb2 b.1.32.1 (B:69-305) Sodium/potassium-transporting ATPase, beta subunit extracellular domain {Dogfish (Squalus acanthias) [TaxId: 7797]}
yqdrvappglshapyaikteisfsisnpksyesfvksmhklmdlynessqagnspfedcs
dtpadyikrgdlddsqgqkkacrfsrmwlkncgyaegkpcvvaklnriigfypkplkntt
dlpeelqanynqyvlplrcaarekigsieyfglggyagfplqyypyygkrlqkkylqpll
aiqftnltqnmelrieckvygenidysekdrfrgrfevkievks

SCOPe Domain Coordinates for d2zxeb2:

Click to download the PDB-style file with coordinates for d2zxeb2.
(The format of our PDB-style files is described here.)

Timeline for d2zxeb2:

  • d2zxeb2 is new in SCOPe 2.06-stable