Lineage for d2zxea3 (2zxe A:167-274)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082621Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2082622Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2082678Protein Sodium/potassium-transporting ATPase, actuator domain A [310693] (2 species)
  7. 2082679Species Dogfish (Squalus acanthias) [TaxId:7797] [310913] (15 PDB entries)
  8. 2082680Domain d2zxea3: 2zxe A:167-274 [304848]
    Other proteins in same PDB: d2zxea1, d2zxea2, d2zxea4, d2zxeb1, d2zxeb2, d2zxeg_
    complexed with clr, k, mf4, mg, nag

Details for d2zxea3

PDB Entry: 2zxe (more details), 2.4 Å

PDB Description: crystal structure of the sodium - potassium pump in the e2.2k+.pi state
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d2zxea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxea3 b.82.7.1 (A:167-274) Sodium/potassium-transporting ATPase, actuator domain A {Dogfish (Squalus acanthias) [TaxId: 7797]}
qqalvirdgekstinaefvvagdlvevkggdripadlriisahgckvdnssltgesepqt
rspefssenpletrniaffstncvegtargvvvytgdrtvmgriatla

SCOPe Domain Coordinates for d2zxea3:

Click to download the PDB-style file with coordinates for d2zxea3.
(The format of our PDB-style files is described here.)

Timeline for d2zxea3: