SCOPe 2.07: Domain d2zxea2: 2zxe A:369-385,A:594-765

Lineage for d2zxea2 (2zxe A:369-385,A:594-765)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 protein domains)
   interrupted by a large insertion, domain N

6. Protein Sodium/potassium-transporting ATPase alpha chain [310692] (2 species)

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [310911] (15 PDB entries)

8. Domain d2zxea2: 2zxe A:369-385,A:594-765 [304847]
   Other proteins in same PDB: d2zxea1, d2zxea3, d2zxea4, d2zxeb1, d2zxeb2, d2zxeg_
   complexed with clr, k, mf4, mg, nag

Details for d2zxea2

PDB Entry: 2zxe, 2.4 Å

PDB Description: Crystal structure of the sodium - potassium pump in the E2.2K+.Pi state

PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d2zxea2:

Sequence; same for both SEQRES and ATOM records:

>d2zxea2 c.108.1.7 (A:369-385,A:594-765) Sodium/potassium-transporting ATPase alpha chain {Dogfish (Squalus acanthias) [TaxId: 7797]}
ststicsdktgtltqnrXppraavpdavgkcrsagikvimvtgdhpitakaiakgvgiis
egnetiediaarlnipigqvnprdakacvvhgsdlkdlstevlddilhyhteivfartsp
qqkliivegcqrqgaivavtgdgvndspalkkadigvamgisgsdvskqaadmillddnf
asivtgveeg

Timeline for d2zxea2:

• d2zxea2 first appeared in SCOPe 2.06