![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins) interrupted by a large insertion, domain N |
![]() | Protein Sodium/potassium-transporting ATPase alpha chain [310692] (2 species) |
![]() | Species Dogfish (Squalus acanthias) [TaxId:7797] [310911] (15 PDB entries) |
![]() | Domain d2zxea2: 2zxe A:369-385,A:594-765 [304847] Other proteins in same PDB: d2zxea1, d2zxea3, d2zxea4, d2zxeb1, d2zxeb2, d2zxeg_ complexed with clr, k, mf4, mg, nag |
PDB Entry: 2zxe (more details), 2.4 Å
SCOPe Domain Sequences for d2zxea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxea2 c.108.1.7 (A:369-385,A:594-765) Sodium/potassium-transporting ATPase alpha chain {Dogfish (Squalus acanthias) [TaxId: 7797]} ststicsdktgtltqnrXppraavpdavgkcrsagikvimvtgdhpitakaiakgvgiis egnetiediaarlnipigqvnprdakacvvhgsdlkdlstevlddilhyhteivfartsp qqkliivegcqrqgaivavtgdgvndspalkkadigvamgisgsdvskqaadmillddnf asivtgveeg
Timeline for d2zxea2: