Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Glutamyl-Q tRNA-Asp synthetase YadB [102257] (1 species) truncated GluRS and GlnRS homologue lacking the anticodon-binding domain; glutamylates the modified base queuosine (Q) of tRNA-Asp |
Species Escherichia coli [TaxId:562] [102258] (3 PDB entries) |
Domain d2zlza_: 2zlz A: [304845] automated match to d1nzja_ protein/RNA complex; complexed with glu, zn |
PDB Entry: 2zlz (more details), 1.75 Å
SCOPe Domain Sequences for d2zlza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zlza_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} dtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilr qlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvl hhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhf qgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpkgd prpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfsnasc
Timeline for d2zlza_: