Lineage for d2zlza_ (2zlz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860086Protein Glutamyl-Q tRNA-Asp synthetase YadB [102257] (1 species)
    truncated GluRS and GlnRS homologue lacking the anticodon-binding domain; glutamylates the modified base queuosine (Q) of tRNA-Asp
  7. 2860087Species Escherichia coli [TaxId:562] [102258] (3 PDB entries)
  8. 2860088Domain d2zlza_: 2zlz A: [304845]
    automated match to d1nzja_
    protein/RNA complex; complexed with glu, zn

Details for d2zlza_

PDB Entry: 2zlz (more details), 1.75 Å

PDB Description: Crystal structure of the E. coli Glutamyl-tRNAAsp synthetase complexed to L-Glu at 1.75 A resolution
PDB Compounds: (A:) glutamyl-q tRNA(asp) synthetase

SCOPe Domain Sequences for d2zlza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlza_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
dtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilr
qlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvl
hhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhf
qgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpkgd
prpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfsnasc

SCOPe Domain Coordinates for d2zlza_:

Click to download the PDB-style file with coordinates for d2zlza_.
(The format of our PDB-style files is described here.)

Timeline for d2zlza_: