| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily) alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234 |
Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) ![]() automatically mapped to Pfam PF09021 |
| Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins) |
| Protein Hut operon positive regulatory protein HutP [111066] (1 species) an RNA-binding antitermination protein |
| Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries) Uniprot P10943 |
| Domain d2zh0c_: 2zh0 C: [304834] automated match to d1veab_ protein/RNA complex; complexed with his, zn |
PDB Entry: 2zh0 (more details), 2.5 Å
SCOPe Domain Sequences for d2zh0c_:
Sequence, based on SEQRES records: (download)
>d2zh0c_ d.275.1.1 (C:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi
>d2zh0c_ d.275.1.1 (C:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi
Timeline for d2zh0c_: