Lineage for d2zh0b_ (2zh0 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2241566Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 2241567Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
    automatically mapped to Pfam PF09021
  5. 2241568Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)
  6. 2241569Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 2241570Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
    Uniprot P10943
  8. 2241575Domain d2zh0b_: 2zh0 B: [304833]
    automated match to d1veab_
    protein/RNA complex; complexed with his, zn

Details for d2zh0b_

PDB Entry: 2zh0 (more details), 2.5 Å

PDB Description: Crystal Structure of ternary complex of HutP(HutP-L-His-Zn)
PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d2zh0b_:

Sequence, based on SEQRES records: (download)

>d2zh0b_ d.275.1.1 (B:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
avslygtigapikglehetfgvginhi

Sequence, based on observed residues (ATOM records): (download)

>d2zh0b_ d.275.1.1 (B:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
tlhkerrigrlsvllllneqveelerdgwkvclgkvgsmdahkviaaietaskksgviqs
egyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsly
gtigapikglehetfgvginhi

SCOPe Domain Coordinates for d2zh0b_:

Click to download the PDB-style file with coordinates for d2zh0b_.
(The format of our PDB-style files is described here.)

Timeline for d2zh0b_: