Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (13 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
Protein Glutathione reductase [51944] (3 species) |
Species Escherichia coli [TaxId:562] [51946] (4 PDB entries) |
Domain d1geta2: 1get A:147-262 [30482] Other proteins in same PDB: d1geta3, d1getb3 |
PDB Entry: 1get (more details), 2 Å
SCOP Domain Sequences for d1geta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geta2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli} dipgveygidsdgffalpalpervavvgagyiavelagvinglgakthlfvrkhaplrsf dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig
Timeline for d1geta2: