Lineage for d2z9ma_ (2z9m A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695386Species Staphylococcus aureus [TaxId:1280] [225593] (6 PDB entries)
  8. 2695389Domain d2z9ma_: 2z9m A: [304800]
    automated match to d2d1va_

Details for d2z9ma_

PDB Entry: 2z9m (more details), 1.87 Å

PDB Description: Crystal structure of YycF DNA-binding domain from Staphylococcus aureus
PDB Compounds: (A:) response regulator YycF

SCOPe Domain Sequences for d2z9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9ma_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh

SCOPe Domain Coordinates for d2z9ma_:

Click to download the PDB-style file with coordinates for d2z9ma_.
(The format of our PDB-style files is described here.)

Timeline for d2z9ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z9mb_