SCOPe 2.08: Domain d2z9ma_: 2z9m A:

Lineage for d2z9ma_ (2z9m A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225593] (6 PDB entries)

8. Domain d2z9ma_: 2z9m A: [304800]
   automated match to d2d1va_

Details for d2z9ma_

PDB Entry: 2z9m, 1.87 Å

PDB Description: Crystal structure of YycF DNA-binding domain from Staphylococcus aureus

PDB Compounds: (A:) response regulator YycF

SCOPe Domain Sequences for d2z9ma_:

Sequence; same for both SEQRES and ATOM records:

>d2z9ma_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
neitikdiviypdaysikkrgedielthrefelfhylskhmgqvmtrehllqtvwgydyf
gdvrtvdvtirrlrekieddpshpeyivtrrgvgyflqqh

Timeline for d2z9ma_:

• d2z9ma_ first appeared in SCOPe 2.06
  
• d2z9ma_ appears in SCOPe 2.07