SCOPe 2.08: Domain d2z0ha_: 2z0h A:

Lineage for d2z0ha_ (2z0h A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188915] (8 PDB entries)

8. Domain d2z0ha_: 2z0h A: [304794]
   automated match to d3hjna_
   complexed with adp, tyd

Details for d2z0ha_

PDB Entry: 2z0h, 2.1 Å

PDB Description: Crystal structure of thymidylate kinase in complex with dTDP and ADP from Thermotoga maritima

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2z0ha_:

Sequence, based on SEQRES records:

>d2z0ha_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrkgelnrfekreflervregylvlarehperivvldgkrsiee
ihrdvvrevkrr

Sequence, based on observed residues (ATOM records):

>d2z0ha_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkvilkrepggtetgekirkilleeevtpkael
flflasrnllvteikqyyavlldrytdssvayqgfgrnlgkeiveelndfatdglipdlt
fyidvdvetalkrknrfekreflervregylvlarehperivvldgkrsieeihrdvvre
vkrr

Timeline for d2z0ha_:

• d2z0ha_ first appeared in SCOPe 2.06
  
• d2z0ha_ appears in SCOPe 2.07