Lineage for d2z0ha_ (2z0h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873015Species Thermotoga maritima [TaxId:243274] [188915] (8 PDB entries)
  8. 2873019Domain d2z0ha_: 2z0h A: [304794]
    automated match to d3hjna_
    complexed with adp, tyd

Details for d2z0ha_

PDB Entry: 2z0h (more details), 2.1 Å

PDB Description: Crystal structure of thymidylate kinase in complex with dTDP and ADP from Thermotoga maritima
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2z0ha_:

Sequence, based on SEQRES records: (download)

>d2z0ha_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae
lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl
ipdltfyidvdvetalkrkgelnrfekreflervregylvlarehperivvldgkrsiee
ihrdvvrevkrr

Sequence, based on observed residues (ATOM records): (download)

>d2z0ha_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mfitfegidgsgkstqiqllaqylekrgkvilkrepggtetgekirkilleeevtpkael
flflasrnllvteikqyyavlldrytdssvayqgfgrnlgkeiveelndfatdglipdlt
fyidvdvetalkrknrfekreflervregylvlarehperivvldgkrsieeihrdvvre
vkrr

SCOPe Domain Coordinates for d2z0ha_:

Click to download the PDB-style file with coordinates for d2z0ha_.
(The format of our PDB-style files is described here.)

Timeline for d2z0ha_: