Lineage for d2z0cb1 (2z0c B:3-189)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106562Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2106563Protein automated matches [190116] (24 species)
    not a true protein
  7. 2106632Species Pyrococcus horikoshii OT3 [TaxId:70601] [311263] (4 PDB entries)
  8. 2106636Domain d2z0cb1: 2z0c B:3-189 [304792]
    Other proteins in same PDB: d2z0ca2, d2z0cb2
    automated match to d3a4ia1

Details for d2z0cb1

PDB Entry: 2z0c (more details), 1.8 Å

PDB Description: Crystal structure of GMP synthetase PH1347 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d2z0cb1:

Sequence, based on SEQRES records: (download)

>d2z0cb1 c.26.2.0 (B:3-189) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
wgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrkge
pefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkigae
yliqgtiapdwiesqgkikshhnvgglpeklnlklieplrdlykdevrelakflglpeki
ynrmpfp

Sequence, based on observed residues (ATOM records): (download)

>d2z0cb1 c.26.2.0 (B:3-189) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
wgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrkge
pefvvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkigae
yliqgtilklieplrdlykdevrelakflglpekiynrmpfp

SCOPe Domain Coordinates for d2z0cb1:

Click to download the PDB-style file with coordinates for d2z0cb1.
(The format of our PDB-style files is described here.)

Timeline for d2z0cb1:

  • d2z0cb1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2z0cb2