Lineage for d2ywua_ (2ywu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2128894Species Thermus thermophilus HB8 [TaxId:300852] [189206] (6 PDB entries)
  8. 2128895Domain d2ywua_: 2ywu A: [304785]
    automated match to d3acba_
    complexed with dio, imp

Details for d2ywua_

PDB Entry: 2ywu (more details), 1.89 Å

PDB Description: Crystal structure of hypoxanthine-guanine phosphoribosyltransferase with IMP from Thermus thermophilus HB8
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d2ywua_:

Sequence, based on SEQRES records: (download)

>d2ywua_ c.61.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplpl
tmdfiaissygnafkssgevellkdlrlpihgrdvivvedivdtgltlsylldylearkp
asvrvaallskpsrrqvevpihylgfeiedayvygygldraqfdrnlpfitsirpe

Sequence, based on observed residues (ATOM records): (download)

>d2ywua_ c.61.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplpl
tmdfiaisellkdlrlpihgrdvivvedivdtgltlsylldylearkpasvrvaallskp
srrqvevpihylgfeiedayvygygldraqfdrnlpfitsirpe

SCOPe Domain Coordinates for d2ywua_:

Click to download the PDB-style file with coordinates for d2ywua_.
(The format of our PDB-style files is described here.)

Timeline for d2ywua_:

  • d2ywua_ is new in SCOPe 2.06-stable