Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (32 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [189206] (6 PDB entries) |
Domain d2ywsa_: 2yws A: [304783] automated match to d3acba_ complexed with dio |
PDB Entry: 2yws (more details), 2.06 Å
SCOPe Domain Sequences for d2ywsa_:
Sequence, based on SEQRES records: (download)
>d2ywsa_ c.61.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} gmftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplp ltmdfiaissygnafkssgevellkdlrlpihgrdvivvedivdtgltlsylldyleark pasvrvaallskpsrrqvevpihylgfeiedayvygygldraqfdrnlpfitsirpee
>d2ywsa_ c.61.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} gmftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplp ltmdfiaisellkdlrlpihgrdvivvedivdtgltlsylldylearkpasvrvaallsk psrrqvevpihylgfeiedayvygygldraqfdrnlpfitsirpee
Timeline for d2ywsa_: