SCOPe 2.08: Domain d2yqma1: 2yqm A:8-89

Lineage for d2yqma1 (2yqm A:8-89)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d2yqma1: 2yqm A:8-89 [304760]
   Other proteins in same PDB: d2yqma2
   automated match to d1z2qa_
   complexed with zn

Details for d2yqma1

PDB Entry: 2yqm

PDB Description: solution structure of the fyve domain in zinc finger fyve domain- containing protein 12

PDB Compounds: (A:) RUN and FYVE domain-containing protein 1

SCOPe Domain Sequences for d2yqma1:

Sequence; same for both SEQRES and ATOM records:

>d2yqma1 g.50.1.0 (A:8-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikevnqalkghawlkddeathcrqcekefsisrrkhhcrncghifcntcssnelalpsyp
kpvrvcdschtlllqrcsstas

Timeline for d2yqma1:

• d2yqma1 first appeared in SCOPe 2.06
  
• d2yqma1 appears in SCOPe 2.07