![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [234160] (3 PDB entries) |
![]() | Domain d2yfgd1: 2yfg D:6-196 [304754] Other proteins in same PDB: d2yfga2, d2yfgb2, d2yfgc2, d2yfgd2, d2yfge2, d2yfgf2 automated match to d4bhta1 complexed with gol |
PDB Entry: 2yfg (more details), 2.5 Å
SCOPe Domain Sequences for d2yfgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfgd1 c.58.1.0 (D:6-196) automated matches {Escherichia coli [TaxId: 562]} slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk lsnntacvftg
Timeline for d2yfgd1: