Lineage for d2yfgd1 (2yfg D:6-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890709Species Escherichia coli [TaxId:562] [234160] (3 PDB entries)
  8. 2890719Domain d2yfgd1: 2yfg D:6-196 [304754]
    Other proteins in same PDB: d2yfga2, d2yfgb2, d2yfgc2, d2yfgd2, d2yfge2, d2yfgf2
    automated match to d4bhta1
    complexed with gol

Details for d2yfgd1

PDB Entry: 2yfg (more details), 2.5 Å

PDB Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases
PDB Compounds: (D:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d2yfgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfgd1 c.58.1.0 (D:6-196) automated matches {Escherichia coli [TaxId: 562]}
slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
vwvddrnqiqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
lsnntacvftg

SCOPe Domain Coordinates for d2yfgd1:

Click to download the PDB-style file with coordinates for d2yfgd1.
(The format of our PDB-style files is described here.)

Timeline for d2yfgd1: