Lineage for d1gesb1 (1ges B:2-146,B:263-335)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67290Protein Glutathione reductase [51944] (2 species)
  7. 67291Species Escherichia coli [TaxId:562] [51946] (4 PDB entries)
  8. 67294Domain d1gesb1: 1ges B:2-146,B:263-335 [30475]
    Other proteins in same PDB: d1gesa3, d1gesb3

Details for d1gesb1

PDB Entry: 1ges (more details), 1.74 Å

PDB Description: anatomy of an engineered nad-binding site

SCOP Domain Sequences for d1gesb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gesb1 c.3.1.5 (B:2-146,B:263-335) Glutathione reductase {Escherichia coli}
tkhydyiaigggsggiasinraamygqkcalieakelggtcvnvgcvpkkvmwhaaqire
aihmygpdygfdttinkfnwetliasrtayidrihtsyenvlgknnvdvikgfarfvdak
tlevngetitadhiliatggrpshpXrepandninleaagvktnekgyivvdkyqntnie
giyavgdntgaveltpvavaagrrlserlfnnkpdehld

SCOP Domain Coordinates for d1gesb1:

Click to download the PDB-style file with coordinates for d1gesb1.
(The format of our PDB-style files is described here.)

Timeline for d1gesb1: