Lineage for d2yfga2 (2yfg A:197-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846812Species Escherichia coli [TaxId:562] [187725] (8 PDB entries)
  8. 2846823Domain d2yfga2: 2yfg A:197-447 [304749]
    Other proteins in same PDB: d2yfga1, d2yfgb1, d2yfgc1, d2yfgd1, d2yfge1, d2yfgf1
    automated match to d4bhta2
    complexed with gol

Details for d2yfga2

PDB Entry: 2yfg (more details), 2.5 Å

PDB Description: Structural Determinants of Cofactor Specificity and Domain Flexibility in Bacterial Glutamate Dehydrogenases
PDB Compounds: (A:) NADP-specific glutamate dehydrogenase

SCOPe Domain Sequences for d2yfga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfga2 c.2.1.0 (A:197-447) automated matches {Escherichia coli [TaxId: 562]}
kglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga
rvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvylegqqpwslpvd
ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg
vatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqganiagfvk
vadamlaqgvi

SCOPe Domain Coordinates for d2yfga2:

Click to download the PDB-style file with coordinates for d2yfga2.
(The format of our PDB-style files is described here.)

Timeline for d2yfga2: