Lineage for d2ydnd2 (2ydn D:165-329)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604996Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (14 PDB entries)
  8. 2605007Domain d2ydnd2: 2ydn D:165-329 [304746]
    Other proteins in same PDB: d2ydna1, d2ydna3, d2ydnb1, d2ydnb3, d2ydnc1, d2ydnc3, d2ydnd1, d2ydnd3
    automated match to d1t2da2
    complexed with bcn, ca, edo, mpd

Details for d2ydnd2

PDB Entry: 2ydn (more details), 1.88 Å

PDB Description: Plasmodium falciparum L-Lactate Dehydrogenase complexed with bicine
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2ydnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ydnd2 d.162.1.1 (D:165-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOPe Domain Coordinates for d2ydnd2:

Click to download the PDB-style file with coordinates for d2ydnd2.
(The format of our PDB-style files is described here.)

Timeline for d2ydnd2: