SCOPe 2.07: Domain d2ydna1: 2ydn A:18-164

Lineage for d2ydna1 (2ydn A:18-164)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (14 PDB entries)

8. Domain d2ydna1: 2ydn A:18-164 [304736]
   Other proteins in same PDB: d2ydna2, d2ydna3, d2ydnb2, d2ydnb3, d2ydnc2, d2ydnc3, d2ydnd2, d2ydnd3
   automated match to d1t2da1
   complexed with bcn, ca, edo, mpd

Details for d2ydna1

PDB Entry: 2ydn, 1.88 Å

PDB Description: Plasmodium falciparum L-Lactate Dehydrogenase complexed with bicine

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2ydna1:

Sequence; same for both SEQRES and ATOM records:

>d2ydna1 c.2.1.5 (A:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

Timeline for d2ydna1:

• d2ydna1 first appeared in SCOPe 2.06
  
• d2ydna1 appears in the current release, SCOPe 2.08