Lineage for d2ydna1 (2ydn A:18-164)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844650Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (14 PDB entries)
  8. 2844657Domain d2ydna1: 2ydn A:18-164 [304736]
    Other proteins in same PDB: d2ydna2, d2ydna3, d2ydnb2, d2ydnb3, d2ydnc2, d2ydnc3, d2ydnd2, d2ydnd3
    automated match to d1t2da1
    complexed with bcn, ca, edo, mpd

Details for d2ydna1

PDB Entry: 2ydn (more details), 1.88 Å

PDB Description: Plasmodium falciparum L-Lactate Dehydrogenase complexed with bicine
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2ydna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ydna1 c.2.1.5 (A:18-164) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiiglg

SCOPe Domain Coordinates for d2ydna1:

Click to download the PDB-style file with coordinates for d2ydna1.
(The format of our PDB-style files is described here.)

Timeline for d2ydna1: