Lineage for d2yc8q_ (2yc8 Q:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435190Species Giardia intestinalis [TaxId:5741] [187625] (8 PDB entries)
  8. 2435233Domain d2yc8q_: 2yc8 Q: [304728]
    automated match to d4bi5f_
    mutant

Details for d2yc8q_

PDB Entry: 2yc8 (more details), 2.7 Å

PDB Description: crystal structure of a double mutant (c202a and c222n) of triosephosphate isomerase from giardia lamblia.
PDB Compounds: (Q:) triosephosphate isomerase

SCOPe Domain Sequences for d2yc8q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yc8q_ c.1.1.0 (Q:) automated matches {Giardia intestinalis [TaxId: 5741]}
parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
tpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsndeklgqcpnidgflvggasl
kpefmtmidiltkt

SCOPe Domain Coordinates for d2yc8q_:

Click to download the PDB-style file with coordinates for d2yc8q_.
(The format of our PDB-style files is described here.)

Timeline for d2yc8q_: