Lineage for d2yc8k_ (2yc8 K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826483Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2826484Protein automated matches [190605] (25 species)
    not a true protein
  7. 2826525Species Giardia intestinalis [TaxId:5741] [187625] (8 PDB entries)
  8. 2826562Domain d2yc8k_: 2yc8 K: [304722]
    automated match to d4bi5f_
    mutant

Details for d2yc8k_

PDB Entry: 2yc8 (more details), 2.7 Å

PDB Description: crystal structure of a double mutant (c202a and c222n) of triosephosphate isomerase from giardia lamblia.
PDB Compounds: (K:) triosephosphate isomerase

SCOPe Domain Sequences for d2yc8k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yc8k_ c.1.1.0 (K:) automated matches {Giardia intestinalis [TaxId: 5741]}
parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
tpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsndeklgqcpnidgflvggasl
kpefmtmidiltkt

SCOPe Domain Coordinates for d2yc8k_:

Click to download the PDB-style file with coordinates for d2yc8k_.
(The format of our PDB-style files is described here.)

Timeline for d2yc8k_: