![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
![]() | Protein automated matches [190605] (25 species) not a true protein |
![]() | Species Giardia intestinalis [TaxId:5741] [187625] (8 PDB entries) |
![]() | Domain d2yc8i_: 2yc8 I: [304720] automated match to d4bi5f_ mutant |
PDB Entry: 2yc8 (more details), 2.7 Å
SCOPe Domain Sequences for d2yc8i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yc8i_ c.1.1.0 (I:) automated matches {Giardia intestinalis [TaxId: 5741]} parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva tpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsndeklgqcpnidgflvggasl kpefmtmidiltkt
Timeline for d2yc8i_: