| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
| Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
| Protein automated matches [190605] (25 species) not a true protein |
| Species Giardia intestinalis [TaxId:5741] [187625] (8 PDB entries) |
| Domain d2yc6a_: 2yc6 A: [304710] automated match to d4bi7a_ complexed with pga; mutant |
PDB Entry: 2yc6 (more details), 1.45 Å
SCOPe Domain Sequences for d2yc6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yc6a_ c.1.1.0 (A:) automated matches {Giardia intestinalis [TaxId: 5741]}
parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
tpeqaeevhvglrkwfvekvaaegaqhiriiyggsangsnneklgqcpnidgflvggasl
kpefmtmidiltktr
Timeline for d2yc6a_: